PHROGS

phrog_25275 is made of 3 protein sequences and is annotated as "membrane protein"
Functional category: moron, auxiliary metabolic gene and host takeover

Average length of proteins	Number of columns in the MSA	Number of conserved columns in the MSA
38.67	39	39

List of all proteins of this PHROG

PHROG prot ID	NCBI prot ID	NCBI prot annotation	Virus ID (click to view)	Virus name	Virus taxonomy
NC_024784_p67	YP_009055407.1	hypothetical protein	NC_024784	Escherichia phage vB_EcoS_AHS24	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Drexlerviridae; Rogunavirinae; Rogunavirus.
KY398841_p70	AQN32420.1	putative membrane protein	KY398841	Escherichia phage vB_Ecos_CEB_EC3a	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Drexlerviridae; Braunvirinae; Guelphvirus; Escherichia virus EC3a.
KF771236_p65	AHI60533.1	hypothetical protein	KF771236	Escherichia phage bV_EcoS_AHP24	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Drexlerviridae; Rogunavirinae; Rogunavirus; Escherichia virus AHS24; Escherichia phage vB_EcoS_AHS24.

PHROGs colocalized to this PHROG

PHROG	#Prot	Annotation	Category	#Neighbors	Probability	Score
no colocalized PHROGS

PHROGs similar to this PHROG

PHROG	Annotation	Category	Probability	Evalue	posQ/posS
no PHROGs similar

PFAMs similar to this PHROG

ID	Definition	Evalue	posQ/posS
no PFAM domain similar to this PHROG

Annotations of the NCBI proteins of this PHROG

2:hypothetical protein 1:membrane protein

KEGG orthologous groups similar to this PHROG

ID	Name : Definition	Pathways	BestScore	#Hits
no KEGG group similar to this PHROG

GO terms in Uniprot proteins similar to this PHROG

ID	Definition
no GO term

Loading in process

>NC_024784_p67
MPSPFVFSKKCYSSDLWIVAGIAMISMTITHKAIFHRLQ
>KY398841_p70
-MTHNVFSKKCYSLDLLIVAYIAMIIMTIAHMAILLQMQ
>KF771236_p65
MPSPFVFSKKCYSSDLWIVAGIAMISMTITHKAIFHRLQ