PHROGS

Average length of proteins	Number of columns in the MSA	Number of conserved columns in the MSA
80.75	83	82

List of all proteins of this PHROG

PHROG prot ID	NCBI prot ID	NCBI prot annotation	Virus ID (click to view)	Virus name	Virus taxonomy
MF288921_p23	ASR79462.1	hypothetical protein	MF288921	Bacillus phage OTooleKemple52	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus; unclassified Bastillevirus.
MF498901_p26	ASU00873.1	hypothetical protein	MF498901	Bacillus phage Anthony	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus; unclassified Bastillevirus.
NC_031024_p43	YP_009280417.1	hypothetical protein	NC_031024	Bacillus phage Belinda	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
KU737346_p27	AMW61778.1	hypothetical protein	KU737346	Bacillus phage Vinny	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus; unclassified Bastillevirus.
NC_031049_p45	YP_009284373.1	hypothetical protein	NC_031049	Bacillus phage NotTheCreek	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_024216_p24	YP_009036927.1	hypothetical protein	NC_024216	Bacillus phage CAM003	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus.
KX961629_p43	AOZ61666.1	hypothetical protein	KX961629	Bacillus phage BJ4	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_031012_p46	YP_009279213.1	hypothetical protein	NC_031012	Bacillus phage Kida	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
MF288922_p23	ASR79961.1	hypothetical protein	MF288922	Bacillus phage Janet	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus; unclassified Bastillevirus.
MF288919_p47	ASR79066.1	hypothetical protein	MF288919	Bacillus phage AaronPhadgers	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
KX961632_p43	AOZ62293.1	hypothetical protein	KX961632	Bacillus phage SBP8a	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
MF288917_p47	ASR78285.1	hypothetical protein	MF288917	Bacillus phage PPIsBest	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_024205_p22	YP_009035219.1	hypothetical protein	NC_024205	Bacillus phage Hoody T	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus; Bacillus virus HoodyT.
MG763894_p44	AUV57684.1	hypothetical protein	MG763894	Bacillus phage HonestAbe	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_023501_p30	YP_009002916.1	hypothetical protein	NC_023501	Bacillus phage BPS10C	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; Bacillus virus BPS10C.
NC_031006_p42	YP_009278063.1	hypothetical protein	NC_031006	Bacillus phage DIGNKC	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_024207_p25	YP_009035546.1	hypothetical protein	NC_024207	Bacillus phage Evoli	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Bastillevirus; Bacillus virus Evoli.
KX156152_p44	ANI24663.1	hypothetical protein	KX156152	Bacillus phage Smudge	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_031054_p47	YP_009284989.1	hypothetical protein	NC_031054	Bacillus phage DirtyBetty	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_024211_p42	YP_009036113.1	hypothetical protein	NC_024211	Bacillus phage Megatron	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus.
NC_031037_p48	YP_009282440.1	hypothetical protein	NC_031037	Bacillus phage Nigalana	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_031070_p47	YP_009286923.1	hypothetical protein	NC_031070	Bacillus phage Nemo	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_016563_p248	YP_004957251.1	gp236	NC_016563	Bacillus phage W.Ph	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus.
NC_031116_p44	YP_009291622.1	hypothetical protein	NC_031116	Bacillus phage Zuko	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_024213_p41	YP_009036490.1	hypothetical protein	NC_024213	Bacillus phage Hakuna	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus.
NC_028944_p49	YP_009211989.1	hypothetical protein	NC_028944	Bacillus phage Eyuki	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus.
MF288920_p47	ASR79260.1	hypothetical protein	MF288920	Bacillus phage Zainny	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.
NC_031027_p47	YP_009280850.1	hypothetical protein	NC_031027	Bacillus phage SageFayge	Viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Bastillevirinae; Wphvirus; unclassified Wphvirus.

PHROGs colocalized to this PHROG

PHROG	#Prot	Annotation	Category	#Neighbors	Probability	Score
phrog_5828	22	no annotation	unknown function	20	1.38E-89	79.98
phrog_7260	16	no annotation	unknown function	14	1.65E-63	53.9
phrog_5638	23	no annotation	unknown function	7	6.52E-29	19.31
phrog_15568	6	no annotation	unknown function	6	0	1000
phrog_8356	13	no annotation	unknown function	5	7.55E-23	13.24
phrog_14416	7	no annotation	unknown function	2	7.98E-12	2.22

PHROGs similar to this PHROG

PHROG	Annotation	Category	Probability	Evalue	posQ/posS
phrog_2670	no annotation	unknown function	96.9	5.8E-06	1-54 / 1-37
phrog_30691	no annotation	unknown function	96.2	8.7E-05	1-51 / 1-63

PFAMs similar to this PHROG

ID	Definition	Evalue	posQ/posS
PF07874.10	Prophage protein (DUF1660)	5.2E-14	2-67 / 1-46

Annotations of the NCBI proteins of this PHROG

28:hypothetical protein

KEGG orthologous groups similar to this PHROG

ID	Name : Definition	Pathways	BestScore	#Hits
no KEGG group similar to this PHROG

GO terms in Uniprot proteins similar to this PHROG

ID	Definition
no GO term

Loading in process

>MF288921_p23
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGESICSRCYDRVTTVRWLPI
VEWERQYTYKELTGRDKKWW---
>MF498901_p26
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGESICSRCYDRVTNVRWLPI
VEWERQYTYKELTGRDEKWW---
>NC_031024_p43
-MSLLCKWFGHKRGDVRPWTPTPLGISRGYTKDEIEVLFTAESRCPRCGTKETELKWFRL
EEWERRYTYKSLGCEFLLKKDLD
>KU737346_p27
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGESICSRCYGRVTNVRWLPI
VEWERQYTYKELTGRDEKWW---
>NC_031049_p45
-MSLLCKWFGHKRGDVRPWKPTPLGISRGYTKEKIEVLFTVESNCPRCGAKETNIKWFRL
EEWENRYTYKTLGCEFLMKRNLD
>NC_024216_p24
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGESICSRCYDRVTNVRWLPI
VEWERQYTYKELTGRDEKWW---
>KX961629_p43
-MSLLCKWFGHKQGEVRPWKPTPLGISRGYTKEKVEVLFTVESNCPRCGAKETELKWFRL
EEWENRYTYKTMGCEFLMKRNLD
>NC_031012_p46
-MSLLCKWFGHKRGDVRPWKPTPLGISRGYTKEKIEVLFTVESNCPRCGAKETNIKWFRL
EEWENRYTYKTLGCEFLMKRNLD
>MF288922_p23
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGEKICSRCYDRVTTVKWLPI
VEWERRYTYKELTGRDKKWW---
>MF288919_p47
-MSLLCKWFGHKRGDVRPWKPTPLGISRGYTKEKIEVLFTVESNCPRCGAKETNIKWFRL
EEWENRYTYKILGCEFLMKRNLD
>KX961632_p43
-MSLLCKWFGHKQGEVRPWKPTPLGISRGYTKEKVEVLFTVESNCPRCGAKETELKWFRL
EEWENRYTYKTMGCEFLMKRNLD
>MF288917_p47
-MSLLCKWFGHKRGDVRPWKPTPLGISRGYTKEKIEVLFTVESNCPRCGAKETNIKWFRL
EEWENRYTYKTLGCEFLMKRNLD
>NC_024205_p22
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGESICSRCYDRVTNVRWLPI
VEWERQYTYKELTGRDEKWW---
>MG763894_p44
-MSLLCKWFGHKRGDVRPWKPTPLGISRGYTKEKIEVLFTVESNCPRCGAKETNIKWFRL
EEWENRYTYKTLGCEFLMKRNLD
>NC_023501_p30
-MSVLCKLLGHKLPVGTPFKPTPVGVARGYFRETTEVLMTIEQDCQRCGEKQTTVQWFKL
EAWERRYTYKSLGCDYLSEKNLD
>NC_031006_p42
-MSLLCKWFGHKRGDVRPWKPTPLGISRGYTKENIEVLFTTESNCPRCGAKETNIKWFRL
EQWENRYTYKTLGCEFLLKRDLD
>NC_024207_p25
MSSLRCKIFGHKLDGGTRVDP--VGVARNKD-GVEQALFTGESICSRCYDRVTNVRWLPI
VEWERQYTYKELTGRDEKWW---
>KX156152_p44
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_031054_p47
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_024211_p42
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_031037_p48
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_031070_p47
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_016563_p248
-MKFLCKLLGHKLKAGNPYRPTPVGVSRGYHRETIEVLMTFELDCERCSERQTKLKWAKL
QDWERRFTYKRLGCEYLMEKNLD
>NC_031116_p44
-MNKWCKWFGHKRGGVLPWKPTPLGISRGYAKEGVEVLFTVESHCPRCGDKITELKWFKL
EEWENRYTYKTMGCEFLLKRDLD
>NC_024213_p41
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_028944_p49
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>MF288920_p47
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD
>NC_031027_p47
-MNKWCKWFGHKRGEVLPWKPTPLGVSRGYVKDEVEVLFSIESHCPRCGDKITEIKWFRL
EEWERRYTYKTLGCEFLLKRNLD